• About Us
    • Overview
    • Education
    • Mission & History
    • Board of Directors
    • The Campus
    • Careers
  • Our Achievements
    • Overview
    • Cancer
    • Technology
    • Education
    • Our Planet
    • Health & Medicine
    • Physical World
  • Get Involved
    • Overview
    • Partners in Science
    • Estate & Planned Giving
    • Attend an Event
    • Gift Opportunities
  • News & Media
    • Overview
    • News & Media Archive
    • Coronavirus
    • Feature Stories
    • News Releases
    • In The News
    • Video Gallery
    • Ad Campaigns
    • Celebrating Great Minds
  • Blog
  • Contact
  • Donate
Donate
Donate
About Us tri
About Us Overview
  • Education
  • Mission & History
  • Board of Directors
  • The Campus
  • Careers
About Us

Founded in 1944, the American Committee for the Weizmann Institute of Science develops philanthropic support for the Weizmann Institute in Israel, and advances its mission of science for the benefit of humanity.

Our Achievements tri
Our Achievements Overview
  • Cancer
  • Technology
  • Education
  • Our Planet
  • Health & Medicine
  • Physical World
Our Achievements

The Weizmann Institute’s fundamental research has led to discoveries and applications with a major impact on the scientific community and on the quality of life for millions worldwide.

Get Involved tri
Get Involved Overview
  • Partners in Science
  • Estate & Planned Giving
  • Attend an Event
  • Gift Opportunities
Get Involved

Join a community of dedicated people who share the Weizmann Institute’s commitment to shaping a better world through science.

News & Media tri
News & Media Overview
  • News & Media Archive
  • Coronavirus
  • Feature Stories
  • News Releases
  • In The News
  • Video Gallery
  • Ad Campaigns
  • Celebrating Great Minds
News & Media

Learn about the Weizmann Institute’s latest groundbreaking discoveries and the American Committee’s activities across the country.

Blog tri
  • The Curiosity Review
Blog

Popular science for the curious-minded: The Curiosity Review brings discovery to life.

Contact

Search Results

  • SEARCH BY KEYWORD
  • SEARCH BY TAG
View Articles by Tag:
  • View Articles by Tag
  • Algorithims (6)
  • Alternative energy (27)
  • Alzheimers (44)
  • Archaeology (37)
  • Artificial intelligence (20)
  • Astrophysics (108)
  • Autism (22)
  • Awards (119)
  • Bacteria (107)
  • Behavior (9)
  • Biochemistry (101)
  • Biofuel (7)
  • Biology (309)
  • Biomolecular sciences (7)
  • Blood (43)
  • Brain (175)
  • Cancer (163)
  • Cancer treatment (127)
  • Central nervous system (9)
  • Chemistry (78)
  • Children (7)
  • Circadian clock (1)
  • Climate change (73)
  • Clinical trials (40)
  • Collaborations (19)
  • Community (279)
  • Computers (73)
  • Copaxone (12)
  • Coronavirus (7)
  • Culture (359)
  • Diabetes (32)
  • Earth (74)
  • Education (157)
  • Environment (92)
  • Enzymes (29)
  • Evolution (89)
  • Fertility (20)
  • Fungus (4)
  • Genetics (109)
  • Genomics (3)
  • Heart (5)
  • Heart disease (3)
  • Humanity (83)
  • Immune system (149)
  • Immunology (10)
  • Immunotherapy (34)
  • Inflammation (19)
  • Leadership (114)
  • Leukemia (12)
  • Materials (44)
  • Mathematics (62)
  • Medicine (84)
  • Memory (39)
  • Mental health (58)
  • Metabolism (51)
  • Microbiology (2)
  • Microbiome (10)
  • Molecular cell biology (9)
  • Molecular genetics (61)
  • Multiple sclerosis (12)
  • Nanoscience (33)
  • Nature (4)
  • Neurobiology (2)
  • Neuroscience (207)
  • Nutrition (72)
  • Optics (34)
  • Organs (11)
  • Parkinsons (11)
  • Personalized medicine (5)
  • Philanthropy (148)
  • Physics (139)
  • Plants (56)
  • Proteins (96)
  • Quantum computer (3)
  • Quantum physics (2)
  • Quantum theory (34)
  • Robots (8)
  • Security (21)
  • Senses (115)
  • Sensors (8)
  • Smoking (1)
  • Solar power (19)
  • Space (110)
  • Stem cells (49)
  • Technology (206)
  • Vaccine (40)
  • Virus (135)
  • Water (40)
  • Weather (1)
  • Women (115)
  • World hunger (17)
Filter by Time:
  • All
  • Past Day
  • Past Week
  • Past Month
  • Past Year
  • Past Three Years
Clear Filters

6 results for Algorithims

Coronavirus by the Numbers
Coronavirus by the Numbers

https://www.weizmann-usa.org/news-media/news-releases/coronavirus-by-the-numbers/

Mar 31, 2020... REHOVOT, ISRAEL—March 31, 2020—Numerical data sometimes reveal facts that are otherwise concealed within an onslaught of information from an overwhelming number of sources. Prof. Ron Milo and research student Yinon Bar-On of the Weizmann Institute of Science’s Department of Plant and Environmental Sciences, together with American colleagues Prof. Rob Phillips of Caltech and Dr. Avi Flamholz of the University of California, Berkeley, have now employed an original research method to organize the flood of coronavirus information in an orderly framework.

TAGS: Culture, Biology, Virus, Algorithims

Self-Monitoring Your Sense of Smell May Help Detect Coronavirus
Self-Monitoring Your Sense of Smell May Help Detect Coronavirus

https://www.weizmann-usa.org/news-media/news-releases/self-monitoring-your-sense-of-smell-may-help-detect-coronavirus/

Apr 02, 2020... REHOVOT, ISRAEL—April 2, 2020—Along with fever, cough, and shortness of breath, many COVID-19 patients report a temporary loss of sense of smell. It appears that olfactory loss is significantly greater in coronavirus patients compared to the loss often experienced during a cold and, less commonly, in influenza (non-COVID-19) patients. In some countries, such as France, a patient who claims to have sudden onset of olfactory loss will be diagnosed as a coronavirus patient – without even being tested. A similar approach is being considered in the U.K. Based on this data, Weizmann Institute of Science investigators, in collaboration with Israel’s Edith Wolfson Medical Center, developed SmellTracker – an online platform that enables self-monitoring of one’s sense of smell – in order to detect early signs of COVID-19, or in the absence of other symptoms.

TAGS: Culture, Biology, Virus, Senses, Algorithims

Coronavirus: The Quest for Solutions – Prof. Eran Segal – Where Will COVID-19 Strike Next?
Coronavirus: The Quest for Solutions – Prof. Eran Segal – Where Will COVID-19 Strike Next?

https://www.weizmann-usa.org/news-media/video-gallery/coronavirus-the-quest-for-solutions-prof-eran-segal-where-will-covid-19-strike-next/

Jun 10, 2020... Prof. Eran Segal provides an update on his symptom-tracking questionnaire and how it can help predict the second wave of COVID-19. As he explains, testing is insufficient...

TAGS: Culture, Biology, Virus, Algorithims, Artificial intelligence

Prof. Yonina Eldar Uses AI Tools to Diagnose COVID-19
Prof. Yonina Eldar Uses AI Tools to Diagnose COVID-19

https://www.weizmann-usa.org/news-media/video-gallery/prof-yonina-eldar-uses-ai-tools-to-diagnose-covid-19/

Aug 24, 2020... In this video, Prof. Yonina Eldar (Department of Computer Science and Applied Mathematics; Head, Biomedical Engineering & Signal Processing Center) discusses her development of novel methods for diagnosing COVID.

TAGS: Technology, Virus, Algorithims, Artificial intelligence

Scientists Advance on One of Technology’s Holy Grails
Scientists Advance on One of Technology’s Holy Grails

https://www.weizmann-usa.org/news-media/in-the-news/scientists-advance-on-one-of-technology-s-holy-grails/

Sep 18, 2020... CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body. The device latches onto the virus and deactivates the part of it that breaks into your cells. It is impossibly tiny—smaller than the virus on which it operates—and it can be manufactured, in tremendous quantities, by your own cells. It’s a protein.

TAGS: Technology, Virus, Proteins, Algorithims

Can the Collective Wisdom of Bugs Help Solve Human Problems?
Can the Collective Wisdom of Bugs Help Solve Human Problems?

https://www.weizmann-usa.org/news-media/in-the-news/can-the-collective-wisdom-of-bugs-help-solve-human-problems/

Dec 08, 2022... Can the Collective Wisdom of Bugs Help Solve Human Problems?

TAGS: Community, Biology, Physics, Evolution, Robots, Algorithims, Behavior, Nature

First 1 Last
SHARE

Our Achievements

Learn more about remarkable Weizmann Institute achievements that are enhancing and transforming our lives.

Learn More

Support Our Flagship Projects

Help us accelerate exciting initiatives in three forward-looking fields: neuroscience, physics, and artificial intelligence.

Learn More

Newsletter

Get the latest news and breakthroughs from the Weizmann Institute of Science.

About Us
  • Education
  • Mission & History
  • Board of Directors
  • The Campus
  • Careers
Our Achievements
  • Cancer
  • Technology
  • Education
  • Our Planet
  • Health & Medicine
  • Physical World
Get Involved
  • Partners in Science
  • Estate & Planned Giving
  • Attend an Event
  • Gift Opportunities
News & Media Blog: Curiosity Review Donate Now Contact Us
Privacy Policy Gift Acceptance Policy Financial Information

©2023 American Committee for the Weizmann Institute of Science

Charity Navigator

FOR THE FOURTH CONSECUTIVE YEAR

Platinum Transparency 2023